PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678398280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 296aa    MW: 33147.5 Da    PI: 8.7005
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678398280genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702110.72.3e-3473129359
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaa 59 
                + +++CqdCGnqakkdC+h RCRtCCksrgf+CathvkstWvpaakrrerqq +   
  678398280  73 NEGMNCQDCGNQAKKDCVHFRCRTCCKSRGFECATHVKSTWVPAAKRRERQQGMVVR 129
                5689**********************************************9876554 PP

2DUF702837.7e-26192245100153
     DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                +e  ++P+evss+a+frcvrv+s+d+ ee++aYqtav+igGh+fkGiLydqGl+
  678398280 192 FELGTFPAEVSSQAIFRCVRVTSMDNTEEQTAYQTAVTIGGHIFKGILYDQGLD 245
                45667***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.0E-5575245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.5E-2777119IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.4E-26197244IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSTFFSLDHN KQQQQAQNYQ LLLKNEEEIY RKGLDLWQQC YQQQQQRPQS QNPYSLDDNN  60
DLGFRSGFRV LRNEGMNCQD CGNQAKKDCV HFRCRTCCKS RGFECATHVK STWVPAAKRR  120
ERQQGMVVRG ESTKRLRETG DGGGSLACAT NPASGFSFTI FFRIRILNLI LFSVKFNLFG  180
LVRGLFVIEG GFELGTFPAE VSSQAIFRCV RVTSMDNTEE QTAYQTAVTI GGHIFKGILY  240
DQGLDGRHHA GTSSGQHLIV PAAAPPSSAG ILEPPFYPTP LNAFMAGTHF FPPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536380.13e-76PREDICTED: protein SHI RELATED SEQUENCE 5
SwissprotQ9LQZ52e-58SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
STRINGVIT_18s0001g13420.t012e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-58Lateral root primordium (LRP) protein-related